PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39375
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 900aa    MW: 100760 Da    PI: 5.6945
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39375genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.7e-29583634152
                     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Tp57577_TGAC_v2_mRNA39375 583 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 634
                                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.859573654IPR003035RWP-RK domain
PfamPF020426.3E-25586634IPR003035RWP-RK domain
SuperFamilySSF542771.13E-24797890No hitNo description
Gene3DG3DSA:3.10.20.2404.8E-23803885No hitNo description
SMARTSM006665.9E-24805888IPR000270PB1 domain
PROSITE profilePS5174526.311805888IPR000270PB1 domain
CDDcd064071.96E-40806887No hitNo description
PfamPF005647.0E-19806887IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 900 aa     Download sequence    Send to blast
MGDGAAVTSS ATMMEGPPQD ENSMDFDYMS ELLLDGCWLE ASADGSEFLL QSSPFSNPIF  60
DPSFSWPSLE NTEPPRNEDG HVGIEQESQI IVNNAGSSDR QQCEFETRSG EGVSRLWIPP  120
TPNPGPGGSF ITEKLIRALK WIKDFNRNKD MLIQIWVPVN RGDDRPILRA NDLPFSLESR  180
SLNLAKYREI SVRYQFSVEE EDSKELVAGL PGRVYRDKIP EWTPDVRFFR SEEYPRVDHA  240
QECDIHGTLA VPVFEQGSRT CLGVIEVVMT TQQSNYGREL ETVCKALEVV DLRSSGHSSL  300
QNVKQACDKS YETALPEIQE VLRSACEMHK LPLAQTWISC IQQGKDGCRH SDDNYANCIS  360
PVEYACYVGD SSVRFFHEAC MEHHLLKGQG VAGGAFMTNQ PCFSADITSL SKTDYPLSHH  420
ARLFGLRAAV AIRLRSIYST SDDYVLEFFL PVDCNDSEEQ KNMLTSLSMI IQRVCRSLRV  480
ITDKELDKDN LPSNEVMAVT DGRFATNAIW SESQHRRMAA SLGGEEKLSE TMSRKFSEQR  540
RQQETLTLKG DLDCGRASSP SVEGTFLSSL GINRTGEKRR AKAEKTITLQ VLRQYFAGSL  600
KDAAKNIGVC TTTLKRICRQ HGIKRWPSRK IKKVGHSLQK LQLVIDSVQG ASGSFQIDSF  660
YSKFSDLSSP RTSLISTLNQ IDNQVSLSTL PDPDSLSPEG ASKSPSSSCS QSSFSSHSCS  720
SMSEQQHRKG NVAIGNKDPS VGEDSVDVVL KRIRSEAELK SLIQDNKTKL MPRSQSQETL  780
GENPKTEHHK SFLKSAPKAS QKEDSHRVKV TFGDEKTRFR LPKNWGYEDL VQEIARRFNV  840
SEMSKFDIKY LDDDYEWVLL TCDADLEECI DVCQSSETST IKLCLQPSSN FIRSSLEFR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462281.10.0plant regulator RWP-RK family protein
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A072V3U80.0A0A072V3U8_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA04G01910.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein